Anti FANCD2OS pAb (ATL-HPA076166)

Atlas Antibodies

Catalog No: ATL-HPA076166-25

• 

Product Description

Protein Description: FANCD2 opposite strand
Gene Name: FANCD2OS
Alternative Gene Name: C3orf24, MGC40179
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033963: 85%, ENSRNOG00000010177: 88%
Entrez Gene ID: 115795
Uniprot ID: Q96PS1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WTPLDESFQWLRHTTPTPSSKHPFKASPCFPHTPSDLEVQLCFQEVTLVLDSPFLESGVSPKLPCHTSELRTMNNKGLVRK
• Gene Sequence: WTPLDESFQWLRHTTPTPSSKHPFKASPCFPHTPSDLEVQLCFQEVTLVLDSPFLESGVSPKLPCHTSELRTMNNKGLVRK
• Gene ID - Mouse: ENSMUSG00000033963
• Gene ID - Rat: ENSRNOG00000010177
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.