Description
Product Description
Protein Description: Fanconi anemia, complementation group D2
Gene Name: FANCD2
Alternative Gene Name: FA-D2, FACD, FAD, FANCD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034023: 72%, ENSRNOG00000061085: 76%
Entrez Gene ID: 2177
Uniprot ID: Q9BXW9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FANCD2
Alternative Gene Name: FA-D2, FACD, FAD, FANCD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034023: 72%, ENSRNOG00000061085: 76%
Entrez Gene ID: 2177
Uniprot ID: Q9BXW9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RLDPNFLLKVRQLVMDKLSSIRLEDLPVIIKFILHSVTAMDTLEVISELREKLDLQHCVLPSRLQASQVKLKSKGRASSSGNQESSGQSCIILLFD |
Gene Sequence | RLDPNFLLKVRQLVMDKLSSIRLEDLPVIIKFILHSVTAMDTLEVISELREKLDLQHCVLPSRLQASQVKLKSKGRASSSGNQESSGQSCIILLFD |
Gene ID - Mouse | ENSMUSG00000034023 |
Gene ID - Rat | ENSRNOG00000061085 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti FANCD2 pAb (ATL-HPA063742) | |
Datasheet | Anti FANCD2 pAb (ATL-HPA063742) Datasheet (External Link) |
Vendor Page | Anti FANCD2 pAb (ATL-HPA063742) at Atlas Antibodies |
Documents & Links for Anti FANCD2 pAb (ATL-HPA063742) | |
Datasheet | Anti FANCD2 pAb (ATL-HPA063742) Datasheet (External Link) |
Vendor Page | Anti FANCD2 pAb (ATL-HPA063742) |