Anti FANCD2 pAb (ATL-HPA063742)

Atlas Antibodies

Catalog No: ATL-HPA063742-25

• 

Product Description

Protein Description: Fanconi anemia, complementation group D2
Gene Name: FANCD2
Alternative Gene Name: FA-D2, FACD, FAD, FANCD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034023: 72%, ENSRNOG00000061085: 76%
Entrez Gene ID: 2177
Uniprot ID: Q9BXW9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RLDPNFLLKVRQLVMDKLSSIRLEDLPVIIKFILHSVTAMDTLEVISELREKLDLQHCVLPSRLQASQVKLKSKGRASSSGNQESSGQSCIILLFD
• Gene Sequence: RLDPNFLLKVRQLVMDKLSSIRLEDLPVIIKFILHSVTAMDTLEVISELREKLDLQHCVLPSRLQASQVKLKSKGRASSSGNQESSGQSCIILLFD
• Gene ID - Mouse: ENSMUSG00000034023
• Gene ID - Rat: ENSRNOG00000061085
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.