Protein Description: Fanconi anemia, complementation group A
Gene Name: FANCA
Alternative Gene Name: FA-H, FAA, FACA, FAH, FANCH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032815: 63%, ENSRNOG00000016706: 60%
Entrez Gene ID: 2175
Uniprot ID: O15360
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FANCA
Alternative Gene Name: FA-H, FAA, FACA, FAH, FANCH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032815: 63%, ENSRNOG00000016706: 60%
Entrez Gene ID: 2175
Uniprot ID: O15360
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LQALTSGWSVAASLQRQRELLMYKRILLRLPSSVLCGSSFQAEQPITARCEQFFHLVNSEMRNFCSHGGALTQDITAHFF |
Documents & Links for Anti FANCA pAb (ATL-HPA063236) | |
Datasheet | Anti FANCA pAb (ATL-HPA063236) Datasheet (External Link) |
Vendor Page | Anti FANCA pAb (ATL-HPA063236) at Atlas |
Documents & Links for Anti FANCA pAb (ATL-HPA063236) | |
Datasheet | Anti FANCA pAb (ATL-HPA063236) Datasheet (External Link) |
Vendor Page | Anti FANCA pAb (ATL-HPA063236) |