Anti FAM96A pAb (ATL-HPA063729)

Catalog No:
ATL-HPA063729-25
$395.00

Description

Product Description

Protein Description: family with sequence similarity 96, member A
Gene Name: FAM96A
Alternative Gene Name: FLJ22875
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032381: 100%, ENSRNOG00000017119: 100%
Entrez Gene ID: 84191
Uniprot ID: Q9H5X1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LATLIGLCLRVKLQRCLPFKHKLEIYISEGTHSTEEDINKQINDKERVAAA
Gene Sequence LATLIGLCLRVKLQRCLPFKHKLEIYISEGTHSTEEDINKQINDKERVAAA
Gene ID - Mouse ENSMUSG00000032381
Gene ID - Rat ENSRNOG00000017119
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti FAM96A pAb (ATL-HPA063729)
Datasheet Anti FAM96A pAb (ATL-HPA063729) Datasheet (External Link)
Vendor Page Anti FAM96A pAb (ATL-HPA063729) at Atlas Antibodies

Documents & Links for Anti FAM96A pAb (ATL-HPA063729)
Datasheet Anti FAM96A pAb (ATL-HPA063729) Datasheet (External Link)
Vendor Page Anti FAM96A pAb (ATL-HPA063729)

Product Description

Protein Description: family with sequence similarity 96, member A
Gene Name: FAM96A
Alternative Gene Name: FLJ22875
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032381: 100%, ENSRNOG00000017119: 100%
Entrez Gene ID: 84191
Uniprot ID: Q9H5X1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LATLIGLCLRVKLQRCLPFKHKLEIYISEGTHSTEEDINKQINDKERVAAA
Gene Sequence LATLIGLCLRVKLQRCLPFKHKLEIYISEGTHSTEEDINKQINDKERVAAA
Gene ID - Mouse ENSMUSG00000032381
Gene ID - Rat ENSRNOG00000017119
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti FAM96A pAb (ATL-HPA063729)
Datasheet Anti FAM96A pAb (ATL-HPA063729) Datasheet (External Link)
Vendor Page Anti FAM96A pAb (ATL-HPA063729) at Atlas Antibodies

Documents & Links for Anti FAM96A pAb (ATL-HPA063729)
Datasheet Anti FAM96A pAb (ATL-HPA063729) Datasheet (External Link)
Vendor Page Anti FAM96A pAb (ATL-HPA063729)