Description
Product Description
Protein Description: family with sequence similarity 96, member A
Gene Name: FAM96A
Alternative Gene Name: FLJ22875
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032381: 100%, ENSRNOG00000017119: 100%
Entrez Gene ID: 84191
Uniprot ID: Q9H5X1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FAM96A
Alternative Gene Name: FLJ22875
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032381: 100%, ENSRNOG00000017119: 100%
Entrez Gene ID: 84191
Uniprot ID: Q9H5X1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LATLIGLCLRVKLQRCLPFKHKLEIYISEGTHSTEEDINKQINDKERVAAA |
Gene Sequence | LATLIGLCLRVKLQRCLPFKHKLEIYISEGTHSTEEDINKQINDKERVAAA |
Gene ID - Mouse | ENSMUSG00000032381 |
Gene ID - Rat | ENSRNOG00000017119 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti FAM96A pAb (ATL-HPA063729) | |
Datasheet | Anti FAM96A pAb (ATL-HPA063729) Datasheet (External Link) |
Vendor Page | Anti FAM96A pAb (ATL-HPA063729) at Atlas Antibodies |
Documents & Links for Anti FAM96A pAb (ATL-HPA063729) | |
Datasheet | Anti FAM96A pAb (ATL-HPA063729) Datasheet (External Link) |
Vendor Page | Anti FAM96A pAb (ATL-HPA063729) |