Protein Description: family with sequence similarity 8 member A1
Gene Name: FAM8A1
Alternative Gene Name: AHCP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069237: 67%, ENSRNOG00000026120: 69%
Entrez Gene ID: 51439
Uniprot ID: Q9UBU6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FAM8A1
Alternative Gene Name: AHCP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069237: 67%, ENSRNOG00000026120: 69%
Entrez Gene ID: 51439
Uniprot ID: Q9UBU6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | NPFYFLSPGAAGPDPRTAAGISTPAPVAGLGPRAPHVQASVRATPVTRVGSAAPSRSPSET |
| Documents & Links for Anti FAM8A1 pAb (ATL-HPA073675) | |
| Datasheet | Anti FAM8A1 pAb (ATL-HPA073675) Datasheet (External Link) |
| Vendor Page | Anti FAM8A1 pAb (ATL-HPA073675) at Atlas |
| Documents & Links for Anti FAM8A1 pAb (ATL-HPA073675) | |
| Datasheet | Anti FAM8A1 pAb (ATL-HPA073675) Datasheet (External Link) |
| Vendor Page | Anti FAM8A1 pAb (ATL-HPA073675) |