Anti FAM8A1 pAb (ATL-HPA073675)

Catalog No:
ATL-HPA073675-25
$447.00

Description

Product Description

Protein Description: family with sequence similarity 8 member A1
Gene Name: FAM8A1
Alternative Gene Name: AHCP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069237: 67%, ENSRNOG00000026120: 69%
Entrez Gene ID: 51439
Uniprot ID: Q9UBU6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NPFYFLSPGAAGPDPRTAAGISTPAPVAGLGPRAPHVQASVRATPVTRVGSAAPSRSPSET
Gene Sequence NPFYFLSPGAAGPDPRTAAGISTPAPVAGLGPRAPHVQASVRATPVTRVGSAAPSRSPSET
Gene ID - Mouse ENSMUSG00000069237
Gene ID - Rat ENSRNOG00000026120
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti FAM8A1 pAb (ATL-HPA073675)
Datasheet Anti FAM8A1 pAb (ATL-HPA073675) Datasheet (External Link)
Vendor Page Anti FAM8A1 pAb (ATL-HPA073675) at Atlas Antibodies

Documents & Links for Anti FAM8A1 pAb (ATL-HPA073675)
Datasheet Anti FAM8A1 pAb (ATL-HPA073675) Datasheet (External Link)
Vendor Page Anti FAM8A1 pAb (ATL-HPA073675)

Product Description

Protein Description: family with sequence similarity 8 member A1
Gene Name: FAM8A1
Alternative Gene Name: AHCP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069237: 67%, ENSRNOG00000026120: 69%
Entrez Gene ID: 51439
Uniprot ID: Q9UBU6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NPFYFLSPGAAGPDPRTAAGISTPAPVAGLGPRAPHVQASVRATPVTRVGSAAPSRSPSET
Gene Sequence NPFYFLSPGAAGPDPRTAAGISTPAPVAGLGPRAPHVQASVRATPVTRVGSAAPSRSPSET
Gene ID - Mouse ENSMUSG00000069237
Gene ID - Rat ENSRNOG00000026120
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti FAM8A1 pAb (ATL-HPA073675)
Datasheet Anti FAM8A1 pAb (ATL-HPA073675) Datasheet (External Link)
Vendor Page Anti FAM8A1 pAb (ATL-HPA073675) at Atlas Antibodies

Documents & Links for Anti FAM8A1 pAb (ATL-HPA073675)
Datasheet Anti FAM8A1 pAb (ATL-HPA073675) Datasheet (External Link)
Vendor Page Anti FAM8A1 pAb (ATL-HPA073675)