Protein Description: family with sequence similarity 83, member F
Gene Name: FAM83F
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022408: 82%, ENSRNOG00000018330: 85%
Entrez Gene ID: 113828
Uniprot ID: Q8NEG4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FAM83F
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022408: 82%, ENSRNOG00000018330: 85%
Entrez Gene ID: 113828
Uniprot ID: Q8NEG4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | SYRFTWSSSHVDRNLLLLLTGQNVEPFDTEFRELYAISEEVDLYRQLSLAGRVGLHYSSTVARKLIN |
Documents & Links for Anti FAM83F pAb (ATL-HPA064657) | |
Datasheet | Anti FAM83F pAb (ATL-HPA064657) Datasheet (External Link) |
Vendor Page | Anti FAM83F pAb (ATL-HPA064657) at Atlas |
Documents & Links for Anti FAM83F pAb (ATL-HPA064657) | |
Datasheet | Anti FAM83F pAb (ATL-HPA064657) Datasheet (External Link) |
Vendor Page | Anti FAM83F pAb (ATL-HPA064657) |