Anti FAM83D pAb (ATL-HPA060854)

Atlas Antibodies

Catalog No: ATL-HPA060854-25

• 

Product Description

Protein Description: family with sequence similarity 83 member D
Gene Name: FAM83D
Alternative Gene Name: C20orf129, CHICA, dJ616B8.3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027654: 61%, ENSRNOG00000015794: 64%
Entrez Gene ID: 81610
Uniprot ID: Q9H4H8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ASSTGSPASIRTTDFHNPGYPKYLGTPHLELYLSDSLRNLNKERQFHFAGIRSRLNHMLAMLSRRTLFTENHLGLHSGNFS
• Gene Sequence: ASSTGSPASIRTTDFHNPGYPKYLGTPHLELYLSDSLRNLNKERQFHFAGIRSRLNHMLAMLSRRTLFTENHLGLHSGNFS
• Gene ID - Mouse: ENSMUSG00000027654
• Gene ID - Rat: ENSRNOG00000015794
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.