Anti FAM81B pAb (ATL-HPA072554)

Atlas Antibodies

Catalog No: ATL-HPA072554-25

• 

Product Description

Protein Description: family with sequence similarity 81, member B
Gene Name: FAM81B
Alternative Gene Name: FLJ25333
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039841: 31%, ENSRNOG00000007662: 31%
Entrez Gene ID: 153643
Uniprot ID: Q96LP2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MQLQFLGTLASSEKRKKSQRLFFKNIKSTKNKAGKASIMSSDTNVNKSASPTATAEEQPVEPDGPLPGSDNNQE
• Gene Sequence: MQLQFLGTLASSEKRKKSQRLFFKNIKSTKNKAGKASIMSSDTNVNKSASPTATAEEQPVEPDGPLPGSDNNQE
• Gene ID - Mouse: ENSMUSG00000039841
• Gene ID - Rat: ENSRNOG00000007662
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.