Protein Description: family with sequence similarity 81, member B
Gene Name: FAM81B
Alternative Gene Name: FLJ25333
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039841: 31%, ENSRNOG00000007662: 31%
Entrez Gene ID: 153643
Uniprot ID: Q96LP2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FAM81B
Alternative Gene Name: FLJ25333
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039841: 31%, ENSRNOG00000007662: 31%
Entrez Gene ID: 153643
Uniprot ID: Q96LP2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | MQLQFLGTLASSEKRKKSQRLFFKNIKSTKNKAGKASIMSSDTNVNKSASPTATAEEQPVEPDGPLPGSDNNQE |
Documents & Links for Anti FAM81B pAb (ATL-HPA072554) | |
Datasheet | Anti FAM81B pAb (ATL-HPA072554) Datasheet (External Link) |
Vendor Page | Anti FAM81B pAb (ATL-HPA072554) at Atlas |
Documents & Links for Anti FAM81B pAb (ATL-HPA072554) | |
Datasheet | Anti FAM81B pAb (ATL-HPA072554) Datasheet (External Link) |
Vendor Page | Anti FAM81B pAb (ATL-HPA072554) |