Anti FAM81A pAb (ATL-HPA065797)

Atlas Antibodies

Catalog No: ATL-HPA065797-25

• 
• 

Product Description

Protein Description: family with sequence similarity 81, member A
Gene Name: FAM81A
Alternative Gene Name: MGC26690
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032224: 81%, ENSRNOG00000057501: 83%
Entrez Gene ID: 145773
Uniprot ID: Q8TBF8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QLSLIVKENSGASERDMEKKLSQMSARLDKIEEGQKKTFDGQRTRQEEEKMHGRITKLELQMNQNIKEMKAEVNAGFTAVYESIGSLRQVLEAKMKLDRDQLQKQIQ
• Gene Sequence: QLSLIVKENSGASERDMEKKLSQMSARLDKIEEGQKKTFDGQRTRQEEEKMHGRITKLELQMNQNIKEMKAEVNAGFTAVYESIGSLRQVLEAKMKLDRDQLQKQIQ
• Gene ID - Mouse: ENSMUSG00000032224
• Gene ID - Rat: ENSRNOG00000057501
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.