Description
Product Description
Protein Description: family with sequence similarity 81, member A
Gene Name: FAM81A
Alternative Gene Name: MGC26690
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032224: 81%, ENSRNOG00000057501: 83%
Entrez Gene ID: 145773
Uniprot ID: Q8TBF8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FAM81A
Alternative Gene Name: MGC26690
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032224: 81%, ENSRNOG00000057501: 83%
Entrez Gene ID: 145773
Uniprot ID: Q8TBF8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QLSLIVKENSGASERDMEKKLSQMSARLDKIEEGQKKTFDGQRTRQEEEKMHGRITKLELQMNQNIKEMKAEVNAGFTAVYESIGSLRQVLEAKMKLDRDQLQKQIQ |
Gene Sequence | QLSLIVKENSGASERDMEKKLSQMSARLDKIEEGQKKTFDGQRTRQEEEKMHGRITKLELQMNQNIKEMKAEVNAGFTAVYESIGSLRQVLEAKMKLDRDQLQKQIQ |
Gene ID - Mouse | ENSMUSG00000032224 |
Gene ID - Rat | ENSRNOG00000057501 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti FAM81A pAb (ATL-HPA065797) | |
Datasheet | Anti FAM81A pAb (ATL-HPA065797) Datasheet (External Link) |
Vendor Page | Anti FAM81A pAb (ATL-HPA065797) at Atlas Antibodies |
Documents & Links for Anti FAM81A pAb (ATL-HPA065797) | |
Datasheet | Anti FAM81A pAb (ATL-HPA065797) Datasheet (External Link) |
Vendor Page | Anti FAM81A pAb (ATL-HPA065797) |