Description
Product Description
Protein Description: family with sequence similarity 78, member B
Gene Name: FAM78B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060568: 100%, ENSRNOG00000051941: 83%
Entrez Gene ID: 149297
Uniprot ID: Q5VT40
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FAM78B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060568: 100%, ENSRNOG00000051941: 83%
Entrez Gene ID: 149297
Uniprot ID: Q5VT40
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IRRENIVVYDVCATIDQCPTRIEETSPIVLRYKTPYFKASAR |
Gene Sequence | IRRENIVVYDVCATIDQCPTRIEETSPIVLRYKTPYFKASAR |
Gene ID - Mouse | ENSMUSG00000060568 |
Gene ID - Rat | ENSRNOG00000051941 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti FAM78B pAb (ATL-HPA073246) | |
Datasheet | Anti FAM78B pAb (ATL-HPA073246) Datasheet (External Link) |
Vendor Page | Anti FAM78B pAb (ATL-HPA073246) at Atlas Antibodies |
Documents & Links for Anti FAM78B pAb (ATL-HPA073246) | |
Datasheet | Anti FAM78B pAb (ATL-HPA073246) Datasheet (External Link) |
Vendor Page | Anti FAM78B pAb (ATL-HPA073246) |