Anti FAM78B pAb (ATL-HPA073246)

Atlas Antibodies

Catalog No: ATL-HPA073246-25

• 

Product Description

Protein Description: family with sequence similarity 78, member B
Gene Name: FAM78B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060568: 100%, ENSRNOG00000051941: 83%
Entrez Gene ID: 149297
Uniprot ID: Q5VT40
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IRRENIVVYDVCATIDQCPTRIEETSPIVLRYKTPYFKASAR
• Gene Sequence: IRRENIVVYDVCATIDQCPTRIEETSPIVLRYKTPYFKASAR
• Gene ID - Mouse: ENSMUSG00000060568
• Gene ID - Rat: ENSRNOG00000051941
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.