Protein Description: family with sequence similarity 46, member A
Gene Name: FAM46A
Alternative Gene Name: C6orf37, FLJ20037
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032265: 87%, ENSRNOG00000010240: 89%
Entrez Gene ID: 55603
Uniprot ID: Q96IP4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FAM46A
Alternative Gene Name: C6orf37, FLJ20037
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032265: 87%, ENSRNOG00000010240: 89%
Entrez Gene ID: 55603
Uniprot ID: Q96IP4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | GYFAMSEDELACSPYIPLGGDFGGGGSFGGHCLDYCESPTAHCNVLNWEQVQRLDGILSETI |
Documents & Links for Anti FAM46A pAb (ATL-HPA067140) | |
Datasheet | Anti FAM46A pAb (ATL-HPA067140) Datasheet (External Link) |
Vendor Page | Anti FAM46A pAb (ATL-HPA067140) at Atlas |
Documents & Links for Anti FAM46A pAb (ATL-HPA067140) | |
Datasheet | Anti FAM46A pAb (ATL-HPA067140) Datasheet (External Link) |
Vendor Page | Anti FAM46A pAb (ATL-HPA067140) |