Protein Description: family with sequence similarity 3, member C
Gene Name: FAM3C
Alternative Gene Name: GS3876, ILEI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029672: 96%, ENSRNOG00000060349: 94%
Entrez Gene ID: 10447
Uniprot ID: Q92520
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FAM3C
Alternative Gene Name: GS3876, ILEI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029672: 96%, ENSRNOG00000060349: 94%
Entrez Gene ID: 10447
Uniprot ID: Q92520
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | MDASLGNLFARSALDTAARSTKPPRYKCGISKACPEKHFAFKMASGAANVV |
Documents & Links for Anti FAM3C pAb (ATL-HPA043376) | |
Datasheet | Anti FAM3C pAb (ATL-HPA043376) Datasheet (External Link) |
Vendor Page | Anti FAM3C pAb (ATL-HPA043376) at Atlas |
Documents & Links for Anti FAM3C pAb (ATL-HPA043376) | |
Datasheet | Anti FAM3C pAb (ATL-HPA043376) Datasheet (External Link) |
Vendor Page | Anti FAM3C pAb (ATL-HPA043376) |