Description
Product Description
Protein Description: family with sequence similarity 3, member A
Gene Name: FAM3A
Alternative Gene Name: 2-19, DXS560S, XAP-7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031399: 88%, ENSRNOG00000060623: 90%
Entrez Gene ID: 60343
Uniprot ID: P98173
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FAM3A
Alternative Gene Name: 2-19, DXS560S, XAP-7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031399: 88%, ENSRNOG00000060623: 90%
Entrez Gene ID: 60343
Uniprot ID: P98173
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GFPRIQQLFTSPESSVTAAPRARKYKCGLPQPCPEEHLAFRVVSGAANVIG |
| Gene Sequence | GFPRIQQLFTSPESSVTAAPRARKYKCGLPQPCPEEHLAFRVVSGAANVIG |
| Gene ID - Mouse | ENSMUSG00000031399 |
| Gene ID - Rat | ENSRNOG00000060623 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti FAM3A pAb (ATL-HPA056991) | |
| Datasheet | Anti FAM3A pAb (ATL-HPA056991) Datasheet (External Link) |
| Vendor Page | Anti FAM3A pAb (ATL-HPA056991) at Atlas Antibodies |
| Documents & Links for Anti FAM3A pAb (ATL-HPA056991) | |
| Datasheet | Anti FAM3A pAb (ATL-HPA056991) Datasheet (External Link) |
| Vendor Page | Anti FAM3A pAb (ATL-HPA056991) |
Citations
| Citations for Anti FAM3A pAb (ATL-HPA056991) – 1 Found |
| Xu, Wenjing; Liang, Minglu; Zhang, Yanqing; Huang, Kai; Wang, Cheng. Endothelial FAM3A positively regulates post-ischaemic angiogenesis. Ebiomedicine. 2019;43( 31000420):32-42. PubMed |