Protein Description:
Gene Name: FAM240C
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054976: 38%, ENSRNOG00000023765: 38%
Entrez Gene ID: 285095
Uniprot ID: A0A1B0GVR7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FAM240C
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054976: 38%, ENSRNOG00000023765: 38%
Entrez Gene ID: 285095
Uniprot ID: A0A1B0GVR7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | RSALNKLRVGWAEQLEGRNKMLQGPGRCPDRVPEATESLHTKDKKAA |
Documents & Links for Anti FAM240C pAb (ATL-HPA073342) | |
Datasheet | Anti FAM240C pAb (ATL-HPA073342) Datasheet (External Link) |
Vendor Page | Anti FAM240C pAb (ATL-HPA073342) at Atlas |
Documents & Links for Anti FAM240C pAb (ATL-HPA073342) | |
Datasheet | Anti FAM240C pAb (ATL-HPA073342) Datasheet (External Link) |
Vendor Page | Anti FAM240C pAb (ATL-HPA073342) |