Protein Description: family with sequence similarity 234 member A
Gene Name: FAM234A
Alternative Gene Name: C16orf9, DKFZP761D0211, FLJ32603, ITFG3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024187: 69%, ENSRNOG00000016502: 27%
Entrez Gene ID: 83986
Uniprot ID: Q9H0X4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FAM234A
Alternative Gene Name: C16orf9, DKFZP761D0211, FLJ32603, ITFG3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024187: 69%, ENSRNOG00000016502: 27%
Entrez Gene ID: 83986
Uniprot ID: Q9H0X4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | REEVSGHLYSGSTGHQIGLRGSLGVDGESGFLLHVTRTGAHYILFPCASSLCGCSVKGLYEKVTGSGGPFKSDPHWESMLNATTRRM |
Documents & Links for Anti FAM234A pAb (ATL-HPA071871) | |
Datasheet | Anti FAM234A pAb (ATL-HPA071871) Datasheet (External Link) |
Vendor Page | Anti FAM234A pAb (ATL-HPA071871) at Atlas |
Documents & Links for Anti FAM234A pAb (ATL-HPA071871) | |
Datasheet | Anti FAM234A pAb (ATL-HPA071871) Datasheet (External Link) |
Vendor Page | Anti FAM234A pAb (ATL-HPA071871) |