Protein Description: family with sequence similarity 228, member B
Gene Name: FAM228B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050545: 76%, ENSRNOG00000049615: 74%
Entrez Gene ID: 375190
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FAM228B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050545: 76%, ENSRNOG00000049615: 74%
Entrez Gene ID: 375190
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | NVDSDDLVTGTLPKLKSSKEWLEPKPLCFMEVLAKEDTEAAIQSILYKENSVIKELDKYLQHHAFLNARRKEMLYKRWVDCVADPLQKK |
Documents & Links for Anti FAM228B pAb (ATL-HPA063357) | |
Datasheet | Anti FAM228B pAb (ATL-HPA063357) Datasheet (External Link) |
Vendor Page | Anti FAM228B pAb (ATL-HPA063357) at Atlas |
Documents & Links for Anti FAM228B pAb (ATL-HPA063357) | |
Datasheet | Anti FAM228B pAb (ATL-HPA063357) Datasheet (External Link) |
Vendor Page | Anti FAM228B pAb (ATL-HPA063357) |