Anti FAM228B pAb (ATL-HPA063357)

Catalog No:
ATL-HPA063357-25
$447.00

Description

Product Description

Protein Description: family with sequence similarity 228, member B
Gene Name: FAM228B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050545: 76%, ENSRNOG00000049615: 74%
Entrez Gene ID: 375190
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NVDSDDLVTGTLPKLKSSKEWLEPKPLCFMEVLAKEDTEAAIQSILYKENSVIKELDKYLQHHAFLNARRKEMLYKRWVDCVADPLQKK
Gene Sequence NVDSDDLVTGTLPKLKSSKEWLEPKPLCFMEVLAKEDTEAAIQSILYKENSVIKELDKYLQHHAFLNARRKEMLYKRWVDCVADPLQKK
Gene ID - Mouse ENSMUSG00000050545
Gene ID - Rat ENSRNOG00000049615
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti FAM228B pAb (ATL-HPA063357)
Datasheet Anti FAM228B pAb (ATL-HPA063357) Datasheet (External Link)
Vendor Page Anti FAM228B pAb (ATL-HPA063357) at Atlas Antibodies

Documents & Links for Anti FAM228B pAb (ATL-HPA063357)
Datasheet Anti FAM228B pAb (ATL-HPA063357) Datasheet (External Link)
Vendor Page Anti FAM228B pAb (ATL-HPA063357)

Product Description

Protein Description: family with sequence similarity 228, member B
Gene Name: FAM228B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050545: 76%, ENSRNOG00000049615: 74%
Entrez Gene ID: 375190
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NVDSDDLVTGTLPKLKSSKEWLEPKPLCFMEVLAKEDTEAAIQSILYKENSVIKELDKYLQHHAFLNARRKEMLYKRWVDCVADPLQKK
Gene Sequence NVDSDDLVTGTLPKLKSSKEWLEPKPLCFMEVLAKEDTEAAIQSILYKENSVIKELDKYLQHHAFLNARRKEMLYKRWVDCVADPLQKK
Gene ID - Mouse ENSMUSG00000050545
Gene ID - Rat ENSRNOG00000049615
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti FAM228B pAb (ATL-HPA063357)
Datasheet Anti FAM228B pAb (ATL-HPA063357) Datasheet (External Link)
Vendor Page Anti FAM228B pAb (ATL-HPA063357) at Atlas Antibodies

Documents & Links for Anti FAM228B pAb (ATL-HPA063357)
Datasheet Anti FAM228B pAb (ATL-HPA063357) Datasheet (External Link)
Vendor Page Anti FAM228B pAb (ATL-HPA063357)