Anti FAM222B pAb (ATL-HPA062239)

Catalog No:
ATL-HPA062239-25
$447.00

Description

Product Description

Protein Description: family with sequence similarity 222, member B
Gene Name: FAM222B
Alternative Gene Name: C17orf63, FLJ10700
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037750: 97%, ENSRNOG00000029570: 96%
Entrez Gene ID: 55731
Uniprot ID: Q8WU58
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AHYRAGTGGGPVASQNSLMQTVDYLSGDFQQACFREQSLAMLSKAHRAPGNRAPDPTESRSLHIQHPGY
Gene Sequence AHYRAGTGGGPVASQNSLMQTVDYLSGDFQQACFREQSLAMLSKAHRAPGNRAPDPTESRSLHIQHPGY
Gene ID - Mouse ENSMUSG00000037750
Gene ID - Rat ENSRNOG00000029570
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti FAM222B pAb (ATL-HPA062239)
Datasheet Anti FAM222B pAb (ATL-HPA062239) Datasheet (External Link)
Vendor Page Anti FAM222B pAb (ATL-HPA062239) at Atlas Antibodies

Documents & Links for Anti FAM222B pAb (ATL-HPA062239)
Datasheet Anti FAM222B pAb (ATL-HPA062239) Datasheet (External Link)
Vendor Page Anti FAM222B pAb (ATL-HPA062239)

Product Description

Protein Description: family with sequence similarity 222, member B
Gene Name: FAM222B
Alternative Gene Name: C17orf63, FLJ10700
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037750: 97%, ENSRNOG00000029570: 96%
Entrez Gene ID: 55731
Uniprot ID: Q8WU58
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AHYRAGTGGGPVASQNSLMQTVDYLSGDFQQACFREQSLAMLSKAHRAPGNRAPDPTESRSLHIQHPGY
Gene Sequence AHYRAGTGGGPVASQNSLMQTVDYLSGDFQQACFREQSLAMLSKAHRAPGNRAPDPTESRSLHIQHPGY
Gene ID - Mouse ENSMUSG00000037750
Gene ID - Rat ENSRNOG00000029570
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti FAM222B pAb (ATL-HPA062239)
Datasheet Anti FAM222B pAb (ATL-HPA062239) Datasheet (External Link)
Vendor Page Anti FAM222B pAb (ATL-HPA062239) at Atlas Antibodies

Documents & Links for Anti FAM222B pAb (ATL-HPA062239)
Datasheet Anti FAM222B pAb (ATL-HPA062239) Datasheet (External Link)
Vendor Page Anti FAM222B pAb (ATL-HPA062239)