Description
Product Description
Protein Description: family with sequence similarity 222, member B
Gene Name: FAM222B
Alternative Gene Name: C17orf63, FLJ10700
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037750: 97%, ENSRNOG00000029570: 96%
Entrez Gene ID: 55731
Uniprot ID: Q8WU58
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FAM222B
Alternative Gene Name: C17orf63, FLJ10700
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037750: 97%, ENSRNOG00000029570: 96%
Entrez Gene ID: 55731
Uniprot ID: Q8WU58
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AHYRAGTGGGPVASQNSLMQTVDYLSGDFQQACFREQSLAMLSKAHRAPGNRAPDPTESRSLHIQHPGY |
Gene Sequence | AHYRAGTGGGPVASQNSLMQTVDYLSGDFQQACFREQSLAMLSKAHRAPGNRAPDPTESRSLHIQHPGY |
Gene ID - Mouse | ENSMUSG00000037750 |
Gene ID - Rat | ENSRNOG00000029570 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti FAM222B pAb (ATL-HPA062239) | |
Datasheet | Anti FAM222B pAb (ATL-HPA062239) Datasheet (External Link) |
Vendor Page | Anti FAM222B pAb (ATL-HPA062239) at Atlas Antibodies |
Documents & Links for Anti FAM222B pAb (ATL-HPA062239) | |
Datasheet | Anti FAM222B pAb (ATL-HPA062239) Datasheet (External Link) |
Vendor Page | Anti FAM222B pAb (ATL-HPA062239) |