Anti FAM219B pAb (ATL-HPA058064)

Atlas Antibodies

Catalog No: ATL-HPA058064-25

• 

Product Description

Protein Description: family with sequence similarity 219, member B
Gene Name: FAM219B
Alternative Gene Name: C15orf17, FLJ00005
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032305: 93%, ENSRNOG00000054468: 91%
Entrez Gene ID: 57184
Uniprot ID: Q5XKK7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AKLQKHRDLAKAVLRRKGMLGASPNRPDSSGKRSVKFNKGYTALSQSPDENLVSLDSD
• Gene Sequence: AKLQKHRDLAKAVLRRKGMLGASPNRPDSSGKRSVKFNKGYTALSQSPDENLVSLDSD
• Gene ID - Mouse: ENSMUSG00000032305
• Gene ID - Rat: ENSRNOG00000054468
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.