Description
Product Description
Protein Description: family with sequence similarity 217, member B
Gene Name: FAM217B
Alternative Gene Name: C20orf177, dJ551D2.5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070476: 66%, ENSRNOG00000053607: 63%
Entrez Gene ID: 63939
Uniprot ID: Q9NTX9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FAM217B
Alternative Gene Name: C20orf177, dJ551D2.5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070476: 66%, ENSRNOG00000053607: 63%
Entrez Gene ID: 63939
Uniprot ID: Q9NTX9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SPGRSKLIASALSKPLPHQEGASKSGPSRKKAFHHEEIHPSHYAFETSPRPIDVLGGTRFCSQRQTLEMRTEE |
Gene Sequence | SPGRSKLIASALSKPLPHQEGASKSGPSRKKAFHHEEIHPSHYAFETSPRPIDVLGGTRFCSQRQTLEMRTEE |
Gene ID - Mouse | ENSMUSG00000070476 |
Gene ID - Rat | ENSRNOG00000053607 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti FAM217B pAb (ATL-HPA056698) | |
Datasheet | Anti FAM217B pAb (ATL-HPA056698) Datasheet (External Link) |
Vendor Page | Anti FAM217B pAb (ATL-HPA056698) at Atlas Antibodies |
Documents & Links for Anti FAM217B pAb (ATL-HPA056698) | |
Datasheet | Anti FAM217B pAb (ATL-HPA056698) Datasheet (External Link) |
Vendor Page | Anti FAM217B pAb (ATL-HPA056698) |