Anti FAM217B pAb (ATL-HPA056698)

Catalog No:
ATL-HPA056698-25
$447.00

Description

Product Description

Protein Description: family with sequence similarity 217, member B
Gene Name: FAM217B
Alternative Gene Name: C20orf177, dJ551D2.5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070476: 66%, ENSRNOG00000053607: 63%
Entrez Gene ID: 63939
Uniprot ID: Q9NTX9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SPGRSKLIASALSKPLPHQEGASKSGPSRKKAFHHEEIHPSHYAFETSPRPIDVLGGTRFCSQRQTLEMRTEE
Gene Sequence SPGRSKLIASALSKPLPHQEGASKSGPSRKKAFHHEEIHPSHYAFETSPRPIDVLGGTRFCSQRQTLEMRTEE
Gene ID - Mouse ENSMUSG00000070476
Gene ID - Rat ENSRNOG00000053607
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti FAM217B pAb (ATL-HPA056698)
Datasheet Anti FAM217B pAb (ATL-HPA056698) Datasheet (External Link)
Vendor Page Anti FAM217B pAb (ATL-HPA056698) at Atlas Antibodies

Documents & Links for Anti FAM217B pAb (ATL-HPA056698)
Datasheet Anti FAM217B pAb (ATL-HPA056698) Datasheet (External Link)
Vendor Page Anti FAM217B pAb (ATL-HPA056698)

Product Description

Protein Description: family with sequence similarity 217, member B
Gene Name: FAM217B
Alternative Gene Name: C20orf177, dJ551D2.5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070476: 66%, ENSRNOG00000053607: 63%
Entrez Gene ID: 63939
Uniprot ID: Q9NTX9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SPGRSKLIASALSKPLPHQEGASKSGPSRKKAFHHEEIHPSHYAFETSPRPIDVLGGTRFCSQRQTLEMRTEE
Gene Sequence SPGRSKLIASALSKPLPHQEGASKSGPSRKKAFHHEEIHPSHYAFETSPRPIDVLGGTRFCSQRQTLEMRTEE
Gene ID - Mouse ENSMUSG00000070476
Gene ID - Rat ENSRNOG00000053607
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti FAM217B pAb (ATL-HPA056698)
Datasheet Anti FAM217B pAb (ATL-HPA056698) Datasheet (External Link)
Vendor Page Anti FAM217B pAb (ATL-HPA056698) at Atlas Antibodies

Documents & Links for Anti FAM217B pAb (ATL-HPA056698)
Datasheet Anti FAM217B pAb (ATL-HPA056698) Datasheet (External Link)
Vendor Page Anti FAM217B pAb (ATL-HPA056698)