Description
Product Description
Protein Description: family with sequence similarity 214, member B
Gene Name: FAM214B
Alternative Gene Name: bA182N22.6, FLJ11560, KIAA1539
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036002: 91%, ENSRNOG00000009323: 91%
Entrez Gene ID: 80256
Uniprot ID: Q7L5A3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FAM214B
Alternative Gene Name: bA182N22.6, FLJ11560, KIAA1539
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036002: 91%, ENSRNOG00000009323: 91%
Entrez Gene ID: 80256
Uniprot ID: Q7L5A3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | CPTKRRLLPAGEAPDVSSEEEGPAPRRRRGSLGHPTAANSSDAKATPFWSHLLPGPKEPVLDPTDCGPMGRRLKGARR |
Gene Sequence | CPTKRRLLPAGEAPDVSSEEEGPAPRRRRGSLGHPTAANSSDAKATPFWSHLLPGPKEPVLDPTDCGPMGRRLKGARR |
Gene ID - Mouse | ENSMUSG00000036002 |
Gene ID - Rat | ENSRNOG00000009323 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti FAM214B pAb (ATL-HPA055751) | |
Datasheet | Anti FAM214B pAb (ATL-HPA055751) Datasheet (External Link) |
Vendor Page | Anti FAM214B pAb (ATL-HPA055751) at Atlas Antibodies |
Documents & Links for Anti FAM214B pAb (ATL-HPA055751) | |
Datasheet | Anti FAM214B pAb (ATL-HPA055751) Datasheet (External Link) |
Vendor Page | Anti FAM214B pAb (ATL-HPA055751) |