Description
Product Description
Protein Description: family with sequence similarity 208, member B
Gene Name: FAM208B
Alternative Gene Name: bA318E3.2, C10orf18, FLJ20360, KIAA2006
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033799: 82%, ENSRNOG00000018011: 81%
Entrez Gene ID: 54906
Uniprot ID: Q5VWN6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FAM208B
Alternative Gene Name: bA318E3.2, C10orf18, FLJ20360, KIAA2006
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033799: 82%, ENSRNOG00000018011: 81%
Entrez Gene ID: 54906
Uniprot ID: Q5VWN6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KEDERVDSTAHKKNIMLKSFQSANIIELLHYHQCDSRSSTKAEILKCLLNLQIQHIDARFAVLLTDKPTIPREVFENNGILVTDVNNFIENIEKIAAPFRSSYW |
Gene Sequence | KEDERVDSTAHKKNIMLKSFQSANIIELLHYHQCDSRSSTKAEILKCLLNLQIQHIDARFAVLLTDKPTIPREVFENNGILVTDVNNFIENIEKIAAPFRSSYW |
Gene ID - Mouse | ENSMUSG00000033799 |
Gene ID - Rat | ENSRNOG00000018011 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti FAM208B pAb (ATL-HPA061547) | |
Datasheet | Anti FAM208B pAb (ATL-HPA061547) Datasheet (External Link) |
Vendor Page | Anti FAM208B pAb (ATL-HPA061547) at Atlas Antibodies |
Documents & Links for Anti FAM208B pAb (ATL-HPA061547) | |
Datasheet | Anti FAM208B pAb (ATL-HPA061547) Datasheet (External Link) |
Vendor Page | Anti FAM208B pAb (ATL-HPA061547) |