Protein Description: family with sequence similarity 187 member B
Gene Name: FAM187B
Alternative Gene Name: FLJ25660, TMEM162
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046826: 51%, ENSRNOG00000021060: 56%
Entrez Gene ID: 148109
Uniprot ID: Q17R55
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FAM187B
Alternative Gene Name: FLJ25660, TMEM162
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046826: 51%, ENSRNOG00000021060: 56%
Entrez Gene ID: 148109
Uniprot ID: Q17R55
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | DNFRLDEKTEFVWLDCPLGSMYRPVNWRANDTPLTWESQLSGQDFTTFLDPSTGGRQLQVFQPAVYKCFVQQELVAQFKPAASLETLE |
Gene ID - Mouse | ENSMUSG00000046826 |
Gene ID - Rat | ENSMUSG00000046826 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FAM187B pAb (ATL-HPA079535 w/enhanced validation) | |
Datasheet | Anti FAM187B pAb (ATL-HPA079535 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti FAM187B pAb (ATL-HPA079535 w/enhanced validation) at Atlas |
Documents & Links for Anti FAM187B pAb (ATL-HPA079535 w/enhanced validation) | |
Datasheet | Anti FAM187B pAb (ATL-HPA079535 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti FAM187B pAb (ATL-HPA079535 w/enhanced validation) |