Polyclonal Antibody against Human FAM186A, Gene description: family with sequence similarity 186 member A, Alternative Gene Names: LOC121006, Validated applications: ICC, Uniprot ID: A6NE01, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DFKVAQVPFTTKKFQMSEVSDTSEETQILRDTFAIESFRTFQSHFTKYRTPVYQTPYTDERALLTLMKPTTSPSSLTTLLRT |
| Gene ID - Mouse | ENSMUSG00000045350 |
| Gene ID - Rat | ENSMUSG00000045350 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti-FAM186A pAb (ATL-HPA064735) | |
| Vendor Page | Anti-FAM186A pAb (ATL-HPA064735) at Atlas |
| Documents & Links for Anti-FAM186A pAb (ATL-HPA064735) | |
| Vendor Page | Anti-FAM186A pAb (ATL-HPA064735) |