Anti FAM181B pAb (ATL-HPA066861)

Catalog No:
ATL-HPA066861-25
$447.00

Description

Product Description

Protein Description: family with sequence similarity 181, member B
Gene Name: FAM181B
Alternative Gene Name: LOC220382, MGC33846
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051515: 43%, ENSRNOG00000010763: 66%
Entrez Gene ID: 220382
Uniprot ID: A6NEQ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PLDVFPAGASVLRGPPELEPGLFEPPPAVVGNLLYPEPWSVPGCSPTKKSPLTAPRGGLTLNEPLSPLYPAAADSP
Gene Sequence PLDVFPAGASVLRGPPELEPGLFEPPPAVVGNLLYPEPWSVPGCSPTKKSPLTAPRGGLTLNEPLSPLYPAAADSP
Gene ID - Mouse ENSMUSG00000051515
Gene ID - Rat ENSRNOG00000010763
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti FAM181B pAb (ATL-HPA066861)
Datasheet Anti FAM181B pAb (ATL-HPA066861) Datasheet (External Link)
Vendor Page Anti FAM181B pAb (ATL-HPA066861) at Atlas Antibodies

Documents & Links for Anti FAM181B pAb (ATL-HPA066861)
Datasheet Anti FAM181B pAb (ATL-HPA066861) Datasheet (External Link)
Vendor Page Anti FAM181B pAb (ATL-HPA066861)

Product Description

Protein Description: family with sequence similarity 181, member B
Gene Name: FAM181B
Alternative Gene Name: LOC220382, MGC33846
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051515: 43%, ENSRNOG00000010763: 66%
Entrez Gene ID: 220382
Uniprot ID: A6NEQ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PLDVFPAGASVLRGPPELEPGLFEPPPAVVGNLLYPEPWSVPGCSPTKKSPLTAPRGGLTLNEPLSPLYPAAADSP
Gene Sequence PLDVFPAGASVLRGPPELEPGLFEPPPAVVGNLLYPEPWSVPGCSPTKKSPLTAPRGGLTLNEPLSPLYPAAADSP
Gene ID - Mouse ENSMUSG00000051515
Gene ID - Rat ENSRNOG00000010763
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti FAM181B pAb (ATL-HPA066861)
Datasheet Anti FAM181B pAb (ATL-HPA066861) Datasheet (External Link)
Vendor Page Anti FAM181B pAb (ATL-HPA066861) at Atlas Antibodies

Documents & Links for Anti FAM181B pAb (ATL-HPA066861)
Datasheet Anti FAM181B pAb (ATL-HPA066861) Datasheet (External Link)
Vendor Page Anti FAM181B pAb (ATL-HPA066861)