Description
Product Description
Protein Description: family with sequence similarity 181, member B
Gene Name: FAM181B
Alternative Gene Name: LOC220382, MGC33846
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051515: 43%, ENSRNOG00000010763: 66%
Entrez Gene ID: 220382
Uniprot ID: A6NEQ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FAM181B
Alternative Gene Name: LOC220382, MGC33846
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051515: 43%, ENSRNOG00000010763: 66%
Entrez Gene ID: 220382
Uniprot ID: A6NEQ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PLDVFPAGASVLRGPPELEPGLFEPPPAVVGNLLYPEPWSVPGCSPTKKSPLTAPRGGLTLNEPLSPLYPAAADSP |
Gene Sequence | PLDVFPAGASVLRGPPELEPGLFEPPPAVVGNLLYPEPWSVPGCSPTKKSPLTAPRGGLTLNEPLSPLYPAAADSP |
Gene ID - Mouse | ENSMUSG00000051515 |
Gene ID - Rat | ENSRNOG00000010763 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti FAM181B pAb (ATL-HPA066861) | |
Datasheet | Anti FAM181B pAb (ATL-HPA066861) Datasheet (External Link) |
Vendor Page | Anti FAM181B pAb (ATL-HPA066861) at Atlas Antibodies |
Documents & Links for Anti FAM181B pAb (ATL-HPA066861) | |
Datasheet | Anti FAM181B pAb (ATL-HPA066861) Datasheet (External Link) |
Vendor Page | Anti FAM181B pAb (ATL-HPA066861) |