Anti FAM177B pAb (ATL-HPA063059)

Atlas Antibodies

Catalog No: ATL-HPA063059-25

• 

Product Description

Protein Description: family with sequence similarity 177, member B
Gene Name: FAM177B
Alternative Gene Name: FLJ43505, RP11-452F19.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022565: 28%, ENSRNOG00000058348: 48%
Entrez Gene ID: 400823
Uniprot ID: A6PVY3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TQPKYQYVLNEFYRIQNKKSDNKSERRGSKAQAAEVPNEKCHLEAGVREYGTIQQDVTEAIPQ
• Gene Sequence: TQPKYQYVLNEFYRIQNKKSDNKSERRGSKAQAAEVPNEKCHLEAGVREYGTIQQDVTEAIPQ
• Gene ID - Mouse: ENSMUSG00000022565
• Gene ID - Rat: ENSRNOG00000058348
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.