Anti FAM173B pAb (ATL-HPA074513)

Atlas Antibodies

Catalog No: ATL-HPA074513-25

• 

Product Description

Protein Description: family with sequence similarity 173, member B
Gene Name: FAM173B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039065: 87%, ENSRNOG00000022347: 84%
Entrez Gene ID: 134145
Uniprot ID: Q6P4H8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TPFVTPALRKVCLPFVPATTKQIENVVKMLRCRRGSLVDIGSGDGRIVIAAAKKGFTAVGY
• Gene Sequence: TPFVTPALRKVCLPFVPATTKQIENVVKMLRCRRGSLVDIGSGDGRIVIAAAKKGFTAVGY
• Gene ID - Mouse: ENSMUSG00000039065
• Gene ID - Rat: ENSRNOG00000022347
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.