Protein Description: family with sequence similarity 173, member B
Gene Name: FAM173B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039065: 87%, ENSRNOG00000022347: 84%
Entrez Gene ID: 134145
Uniprot ID: Q6P4H8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FAM173B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039065: 87%, ENSRNOG00000022347: 84%
Entrez Gene ID: 134145
Uniprot ID: Q6P4H8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | TPFVTPALRKVCLPFVPATTKQIENVVKMLRCRRGSLVDIGSGDGRIVIAAAKKGFTAVGY |
Documents & Links for Anti FAM173B pAb (ATL-HPA074513) | |
Datasheet | Anti FAM173B pAb (ATL-HPA074513) Datasheet (External Link) |
Vendor Page | Anti FAM173B pAb (ATL-HPA074513) at Atlas |
Documents & Links for Anti FAM173B pAb (ATL-HPA074513) | |
Datasheet | Anti FAM173B pAb (ATL-HPA074513) Datasheet (External Link) |
Vendor Page | Anti FAM173B pAb (ATL-HPA074513) |