![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/92557/168664/atl-hpa043624_anti-fam160b1-pab-atl-hpa043624_50311__62294.1681121920.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp")
Protein Description: family with sequence similarity 160, member B1
Gene Name: FAM160B1
Alternative Gene Name: bA106M7.3, KIAA1600
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033478: 78%, ENSRNOG00000017225: 76%
Entrez Gene ID: 57700
Uniprot ID: Q5W0V3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FAM160B1
Alternative Gene Name: bA106M7.3, KIAA1600
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033478: 78%, ENSRNOG00000017225: 76%
Entrez Gene ID: 57700
Uniprot ID: Q5W0V3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | CGEVLATPTENEEIQFLCIVCAKLKQDPYLVNFFLENKMKSLASKGVPNVISEDTLKGQDSLSTDTGQSRQPEELSGATGMEQTELEDEPPHQMDHL |
| Documents & Links for Anti FAM160B1 pAb (ATL-HPA043624) | |
| Datasheet | Anti FAM160B1 pAb (ATL-HPA043624) Datasheet (External Link) |
| Vendor Page | Anti FAM160B1 pAb (ATL-HPA043624) at Atlas |
| Documents & Links for Anti FAM160B1 pAb (ATL-HPA043624) | |
| Datasheet | Anti FAM160B1 pAb (ATL-HPA043624) Datasheet (External Link) |
| Vendor Page | Anti FAM160B1 pAb (ATL-HPA043624) |