Description
Product Description
Protein Description: family with sequence similarity 160, member A2
Gene Name: FAM160A2
Alternative Gene Name: C11orf56, DKFZP566M1046, FLJ22665, KIAA1759
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044465: 75%, ENSRNOG00000042195: 32%
Entrez Gene ID: 84067
Uniprot ID: Q8N612
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FAM160A2
Alternative Gene Name: C11orf56, DKFZP566M1046, FLJ22665, KIAA1759
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044465: 75%, ENSRNOG00000042195: 32%
Entrez Gene ID: 84067
Uniprot ID: Q8N612
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GSRTKKRSLLPEEDRNNVGEGEEEELGRRGRAGGAGEGPGHLPPPQLNGVPGSWPEGAKKVRLVPKEGAGELL |
Gene Sequence | GSRTKKRSLLPEEDRNNVGEGEEEELGRRGRAGGAGEGPGHLPPPQLNGVPGSWPEGAKKVRLVPKEGAGELL |
Gene ID - Mouse | ENSMUSG00000044465 |
Gene ID - Rat | ENSRNOG00000042195 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti FAM160A2 pAb (ATL-HPA055994) | |
Datasheet | Anti FAM160A2 pAb (ATL-HPA055994) Datasheet (External Link) |
Vendor Page | Anti FAM160A2 pAb (ATL-HPA055994) at Atlas Antibodies |
Documents & Links for Anti FAM160A2 pAb (ATL-HPA055994) | |
Datasheet | Anti FAM160A2 pAb (ATL-HPA055994) Datasheet (External Link) |
Vendor Page | Anti FAM160A2 pAb (ATL-HPA055994) |