Protein Description: family with sequence similarity 13, member B
Gene Name: FAM13B
Alternative Gene Name: ARHGAP49, C5orf5, FAM13B1, KHCHP, N61
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036501: 100%, ENSRNOG00000020384: 100%
Entrez Gene ID: 51306
Uniprot ID: Q9NYF5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FAM13B
Alternative Gene Name: ARHGAP49, C5orf5, FAM13B1, KHCHP, N61
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036501: 100%, ENSRNOG00000020384: 100%
Entrez Gene ID: 51306
Uniprot ID: Q9NYF5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | YSLLKFLCRFLANVASHHEEIWSANSLAAVFGPDVFHIYTDVEDMKEQEIVSRIMAGLLENYYEFFENEEEDFSSNDLSSI |
Documents & Links for Anti FAM13B pAb (ATL-HPA071936) | |
Datasheet | Anti FAM13B pAb (ATL-HPA071936) Datasheet (External Link) |
Vendor Page | Anti FAM13B pAb (ATL-HPA071936) at Atlas |
Documents & Links for Anti FAM13B pAb (ATL-HPA071936) | |
Datasheet | Anti FAM13B pAb (ATL-HPA071936) Datasheet (External Link) |
Vendor Page | Anti FAM13B pAb (ATL-HPA071936) |