![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/92147/167946/atl-hpa042800_anti-fam131a-pab-atl-hpa042800_49593__61644.1681121072.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp")
Protein Description: family with sequence similarity 131, member A
Gene Name: FAM131A
Alternative Gene Name: C3orf40, MGC21688
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050821: 87%, ENSRNOG00000046177: 85%
Entrez Gene ID: 131408
Uniprot ID: Q6UXB0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FAM131A
Alternative Gene Name: C3orf40, MGC21688
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050821: 87%, ENSRNOG00000046177: 85%
Entrez Gene ID: 131408
Uniprot ID: Q6UXB0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ELLLAKLPPSRESAFRSLGPLEAQDSLYNSPLTESCLSPAEEEPAPCKDCQPLCPPLTGSWERQRQASDLASSGVVSL |
| Documents & Links for Anti FAM131A pAb (ATL-HPA042800) | |
| Datasheet | Anti FAM131A pAb (ATL-HPA042800) Datasheet (External Link) |
| Vendor Page | Anti FAM131A pAb (ATL-HPA042800) at Atlas |
| Documents & Links for Anti FAM131A pAb (ATL-HPA042800) | |
| Datasheet | Anti FAM131A pAb (ATL-HPA042800) Datasheet (External Link) |
| Vendor Page | Anti FAM131A pAb (ATL-HPA042800) |