Description
Product Description
Protein Description: family with sequence similarity 126, member B
Gene Name: FAM126B
Alternative Gene Name: HYCC2, MGC39518
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038174: 91%, ENSRNOG00000010517: 34%
Entrez Gene ID: 285172
Uniprot ID: Q8IXS8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FAM126B
Alternative Gene Name: HYCC2, MGC39518
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038174: 91%, ENSRNOG00000010517: 34%
Entrez Gene ID: 285172
Uniprot ID: Q8IXS8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | INSLSLIRTASASSSKSFDYVNGSQASTSIGVGTEGGTNLAANNANRYSTVSLQEDRLGQAGEGKELL |
Gene Sequence | INSLSLIRTASASSSKSFDYVNGSQASTSIGVGTEGGTNLAANNANRYSTVSLQEDRLGQAGEGKELL |
Gene ID - Mouse | ENSMUSG00000038174 |
Gene ID - Rat | ENSRNOG00000010517 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti FAM126B pAb (ATL-HPA067307) | |
Datasheet | Anti FAM126B pAb (ATL-HPA067307) Datasheet (External Link) |
Vendor Page | Anti FAM126B pAb (ATL-HPA067307) at Atlas Antibodies |
Documents & Links for Anti FAM126B pAb (ATL-HPA067307) | |
Datasheet | Anti FAM126B pAb (ATL-HPA067307) Datasheet (External Link) |
Vendor Page | Anti FAM126B pAb (ATL-HPA067307) |