Description
Product Description
Protein Description: family with sequence similarity 120A
Gene Name: FAM120A
Alternative Gene Name: C9orf10, DNAPTP1, KIAA0183, OSSA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038014: 96%, ENSRNOG00000016779: 90%
Entrez Gene ID: 23196
Uniprot ID: Q9NZB2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FAM120A
Alternative Gene Name: C9orf10, DNAPTP1, KIAA0183, OSSA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038014: 96%, ENSRNOG00000016779: 90%
Entrez Gene ID: 23196
Uniprot ID: Q9NZB2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FYPASAYPRHFGPVPPSQGRGRGFAGVCGFGGPYGETVATGPYRAFRVAAASGHCGAFSGSDSSRTSKSQGGVQPIP |
Gene Sequence | FYPASAYPRHFGPVPPSQGRGRGFAGVCGFGGPYGETVATGPYRAFRVAAASGHCGAFSGSDSSRTSKSQGGVQPIP |
Gene ID - Mouse | ENSMUSG00000038014 |
Gene ID - Rat | ENSRNOG00000016779 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti FAM120A pAb (ATL-HPA055800) | |
Datasheet | Anti FAM120A pAb (ATL-HPA055800) Datasheet (External Link) |
Vendor Page | Anti FAM120A pAb (ATL-HPA055800) at Atlas Antibodies |
Documents & Links for Anti FAM120A pAb (ATL-HPA055800) | |
Datasheet | Anti FAM120A pAb (ATL-HPA055800) Datasheet (External Link) |
Vendor Page | Anti FAM120A pAb (ATL-HPA055800) |