Protein Description: family with sequence similarity 114, member A1
Gene Name: FAM114A1
Alternative Gene Name: Noxp20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029185: 49%, ENSRNOG00000002110: 47%
Entrez Gene ID: 92689
Uniprot ID: Q8IWE2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FAM114A1
Alternative Gene Name: Noxp20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029185: 49%, ENSRNOG00000002110: 47%
Entrez Gene ID: 92689
Uniprot ID: Q8IWE2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | MSDDAGDTLATGDKAEVTEMPNSDSLPEDAEVHCDSAAVSHEPTPADPRGEGHENAAVQGAG |
Documents & Links for Anti FAM114A1 pAb (ATL-HPA069701) | |
Datasheet | Anti FAM114A1 pAb (ATL-HPA069701) Datasheet (External Link) |
Vendor Page | Anti FAM114A1 pAb (ATL-HPA069701) at Atlas |
Documents & Links for Anti FAM114A1 pAb (ATL-HPA069701) | |
Datasheet | Anti FAM114A1 pAb (ATL-HPA069701) Datasheet (External Link) |
Vendor Page | Anti FAM114A1 pAb (ATL-HPA069701) |