Anti FAM114A1 pAb (ATL-HPA069701)

Atlas Antibodies

Catalog No: ATL-HPA069701-25

• 
• 

Product Description

Protein Description: family with sequence similarity 114, member A1
Gene Name: FAM114A1
Alternative Gene Name: Noxp20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029185: 49%, ENSRNOG00000002110: 47%
Entrez Gene ID: 92689
Uniprot ID: Q8IWE2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSDDAGDTLATGDKAEVTEMPNSDSLPEDAEVHCDSAAVSHEPTPADPRGEGHENAAVQGAG
• Gene Sequence: MSDDAGDTLATGDKAEVTEMPNSDSLPEDAEVHCDSAAVSHEPTPADPRGEGHENAAVQGAG
• Gene ID - Mouse: ENSMUSG00000029185
• Gene ID - Rat: ENSRNOG00000002110
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.