Anti FAM110A pAb (ATL-HPA069240)

Atlas Antibodies

Catalog No: ATL-HPA069240-25

• 
• 

Product Description

Protein Description: family with sequence similarity 110, member A
Gene Name: FAM110A
Alternative Gene Name: bA371L19.3, C20orf55
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027459: 84%, ENSRNOG00000050946: 84%
Entrez Gene ID: 83541
Uniprot ID: Q9BQ89
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MPVHTLSPGAPSAPALPCRLRTRVPGYLLRGPADGGARKPSAVE
• Gene Sequence: MPVHTLSPGAPSAPALPCRLRTRVPGYLLRGPADGGARKPSAVE
• Gene ID - Mouse: ENSMUSG00000027459
• Gene ID - Rat: ENSRNOG00000050946
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.