Protein Description: family with sequence similarity 107 member B
Gene Name: FAM107B
Alternative Gene Name: C10orf45, FLJ45505, HITS, MGC11034
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026655: 99%, ENSRNOG00000014886: 99%
Entrez Gene ID: 83641
Uniprot ID: Q9H098
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FAM107B
Alternative Gene Name: C10orf45, FLJ45505, HITS, MGC11034
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026655: 99%, ENSRNOG00000014886: 99%
Entrez Gene ID: 83641
Uniprot ID: Q9H098
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LHRELLMNQKRGLAPQNKPELQKVMEKRKRDQVIKQKEEEAQKKKSDLEIELLKRQQKLEQLELEKQ |
| Documents & Links for Anti FAM107B pAb (ATL-HPA073195) | |
| Datasheet | Anti FAM107B pAb (ATL-HPA073195) Datasheet (External Link) |
| Vendor Page | Anti FAM107B pAb (ATL-HPA073195) at Atlas |
| Documents & Links for Anti FAM107B pAb (ATL-HPA073195) | |
| Datasheet | Anti FAM107B pAb (ATL-HPA073195) Datasheet (External Link) |
| Vendor Page | Anti FAM107B pAb (ATL-HPA073195) |