Anti FAIM2 pAb (ATL-HPA048800 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA048800-100

• 
• 

Product Description

Protein Description: Fas apoptotic inhibitory molecule 2
Gene Name: FAIM2
Alternative Gene Name: KIAA0950, LFG, LFG2, LIFEGUARD, NMP35, TMBIM2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023011: 82%, ENSRNOG00000053258: 82%
Entrez Gene ID: 23017
Uniprot ID: Q9BWQ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PTAVPLHPSWAYVDPSSSSSYDNGFPTGDHELFTTFSWDDQKVRRVFVRKV
• Gene Sequence: PTAVPLHPSWAYVDPSSSSSYDNGFPTGDHELFTTFSWDDQKVRRVFVRKV
• Gene ID - Mouse: ENSMUSG00000023011
• Gene ID - Rat: ENSRNOG00000053258
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.