Protein Description: Fas associated factor family member 2
Gene Name: FAF2
Alternative Gene Name: ETEA, KIAA0887, UBXD8, UBXN3B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025873: 93%, ENSRNOG00000017607: 93%
Entrez Gene ID: 23197
Uniprot ID: Q96CS3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FAF2
Alternative Gene Name: ETEA, KIAA0887, UBXD8, UBXN3B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025873: 93%, ENSRNOG00000017607: 93%
Entrez Gene ID: 23197
Uniprot ID: Q96CS3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | MAAPEERDLTQEQTEKLLQFQDLTGIESMDQCRHTLEQHNWNIEAAVQDRLNEQEGVPSVFNPPPSRPLQVNTADHRIYSYVVSRPQPR |
| Documents & Links for Anti FAF2 pAb (ATL-HPA073828) | |
| Datasheet | Anti FAF2 pAb (ATL-HPA073828) Datasheet (External Link) |
| Vendor Page | Anti FAF2 pAb (ATL-HPA073828) at Atlas |
| Documents & Links for Anti FAF2 pAb (ATL-HPA073828) | |
| Datasheet | Anti FAF2 pAb (ATL-HPA073828) Datasheet (External Link) |
| Vendor Page | Anti FAF2 pAb (ATL-HPA073828) |