Description
Product Description
Protein Description: Fas associated factor family member 2
Gene Name: FAF2
Alternative Gene Name: ETEA, KIAA0887, UBXD8, UBXN3B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025873: 100%, ENSRNOG00000017607: 100%
Entrez Gene ID: 23197
Uniprot ID: Q96CS3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: FAF2
Alternative Gene Name: ETEA, KIAA0887, UBXD8, UBXN3B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025873: 100%, ENSRNOG00000017607: 100%
Entrez Gene ID: 23197
Uniprot ID: Q96CS3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EGYRVSQALRENTYPFLAMIMLKDRRMTVVGRLEGLIQPDDLINQLTFIMDANQTYLVSERLEREERNQTQVL |
Gene Sequence | EGYRVSQALRENTYPFLAMIMLKDRRMTVVGRLEGLIQPDDLINQLTFIMDANQTYLVSERLEREERNQTQVL |
Gene ID - Mouse | ENSMUSG00000025873 |
Gene ID - Rat | ENSRNOG00000017607 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti FAF2 pAb (ATL-HPA071246) | |
Datasheet | Anti FAF2 pAb (ATL-HPA071246) Datasheet (External Link) |
Vendor Page | Anti FAF2 pAb (ATL-HPA071246) at Atlas Antibodies |
Documents & Links for Anti FAF2 pAb (ATL-HPA071246) | |
Datasheet | Anti FAF2 pAb (ATL-HPA071246) Datasheet (External Link) |
Vendor Page | Anti FAF2 pAb (ATL-HPA071246) |