Anti F3 pAb (ATL-HPA069132)

Atlas Antibodies

Catalog No: ATL-HPA069132-25

• 
• 

Product Description

Protein Description: coagulation factor III (thromboplastin, tissue factor)
Gene Name: F3
Alternative Gene Name: CD142
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028128: 70%, ENSRNOG00000011800: 68%
Entrez Gene ID: 2152
Uniprot ID: P13726
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDV
• Gene Sequence: GTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDV
• Gene ID - Mouse: ENSMUSG00000028128
• Gene ID - Rat: ENSRNOG00000011800
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations

Citations for Anti F3 pAb (ATL-HPA069132) – 1 Found

Rosell, Axel; Moser, Bernhard; Hisada, Yohei; Chinthapatla, Rukesh; Lian, Grace; Yang, Yi; Flick, Matthew J; Mackman, Nigel. Evaluation of different commercial antibodies for their ability to detect human and mouse tissue factor by western blotting. Research And Practice In Thrombosis And Haemostasis. 2020;4(6):1013-1023.