Protein Description: EYA transcriptional coactivator and phosphatase 4
Gene Name: EYA4
Alternative Gene Name: CMD1J, DFNA10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010461: 94%, ENSRNOG00000016627: 60%
Entrez Gene ID: 2070
Uniprot ID: O95677
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: EYA4
Alternative Gene Name: CMD1J, DFNA10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010461: 94%, ENSRNOG00000016627: 60%
Entrez Gene ID: 2070
Uniprot ID: O95677
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TGGENMTVLNTADWLLSCNTPSSATMSLLAVKTEPLNSSETTATTGDGALDTFTGSVITSSGYSPRSA |
Gene Sequence | TGGENMTVLNTADWLLSCNTPSSATMSLLAVKTEPLNSSETTATTGDGALDTFTGSVITSSGYSPRSA |
Gene ID - Mouse | ENSMUSG00000010461 |
Gene ID - Rat | ENSRNOG00000016627 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti EYA4 pAb (ATL-HPA038771 w/enhanced validation) | |
Datasheet | Anti EYA4 pAb (ATL-HPA038771 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti EYA4 pAb (ATL-HPA038771 w/enhanced validation) at Atlas |
Documents & Links for Anti EYA4 pAb (ATL-HPA038771 w/enhanced validation) | |
Datasheet | Anti EYA4 pAb (ATL-HPA038771 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti EYA4 pAb (ATL-HPA038771 w/enhanced validation) |