Protein Description: exostosin-like glycosyltransferase 2
Gene Name: EXTL2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027963: 89%, ENSRNOG00000014323: 90%
Entrez Gene ID: 2135
Uniprot ID: Q9UBQ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: EXTL2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027963: 89%, ENSRNOG00000014323: 90%
Entrez Gene ID: 2135
Uniprot ID: Q9UBQ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | TANRMRNRLQVFPELETNAVLMVDDDTLISTPDLVFAFSVWQQFPDQIVGFVPRKHVSTSSGIYSYGSFEM |
Documents & Links for Anti EXTL2 pAb (ATL-HPA068921) | |
Datasheet | Anti EXTL2 pAb (ATL-HPA068921) Datasheet (External Link) |
Vendor Page | Anti EXTL2 pAb (ATL-HPA068921) at Atlas |
Documents & Links for Anti EXTL2 pAb (ATL-HPA068921) | |
Datasheet | Anti EXTL2 pAb (ATL-HPA068921) Datasheet (External Link) |
Vendor Page | Anti EXTL2 pAb (ATL-HPA068921) |