Description
Product Description
Protein Description: exosome component 4
Gene Name: EXOSC4
Alternative Gene Name: FLJ20591, hRrp41p, p12A, RRP41, RRP41A, Rrp41p, SKI6, Ski6p
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034259: 99%, ENSRNOG00000012348: 99%
Entrez Gene ID: 54512
Uniprot ID: Q9NPD3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: EXOSC4
Alternative Gene Name: FLJ20591, hRrp41p, p12A, RRP41, RRP41A, Rrp41p, SKI6, Ski6p
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034259: 99%, ENSRNOG00000012348: 99%
Entrez Gene ID: 54512
Uniprot ID: Q9NPD3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PHGDRKSCEMGLQLRQTFEAAILTQLHPRSQIDIYVQVLQADGGTYAACVNAATLAVLDAGIPMRDFVCACSA |
Gene Sequence | PHGDRKSCEMGLQLRQTFEAAILTQLHPRSQIDIYVQVLQADGGTYAACVNAATLAVLDAGIPMRDFVCACSA |
Gene ID - Mouse | ENSMUSG00000034259 |
Gene ID - Rat | ENSRNOG00000012348 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti EXOSC4 pAb (ATL-HPA065103) | |
Datasheet | Anti EXOSC4 pAb (ATL-HPA065103) Datasheet (External Link) |
Vendor Page | Anti EXOSC4 pAb (ATL-HPA065103) at Atlas Antibodies |
Documents & Links for Anti EXOSC4 pAb (ATL-HPA065103) | |
Datasheet | Anti EXOSC4 pAb (ATL-HPA065103) Datasheet (External Link) |
Vendor Page | Anti EXOSC4 pAb (ATL-HPA065103) |