Protein Description: exocyst complex component 6B
Gene Name: EXOC6B
Alternative Gene Name: KIAA0919, SEC15B, SEC15L2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033769: 80%, ENSRNOG00000059615: 78%
Entrez Gene ID: 23233
Uniprot ID: Q9Y2D4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: EXOC6B
Alternative Gene Name: KIAA0919, SEC15B, SEC15L2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033769: 80%, ENSRNOG00000059615: 78%
Entrez Gene ID: 23233
Uniprot ID: Q9Y2D4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | TNLNQKIDQFLQLADYDWMTGDLGNKASDYLVDLIAFLRSTFAVFTHLPVSGSCYFVLYI |
| Documents & Links for Anti EXOC6B pAb (ATL-HPA063991) | |
| Datasheet | Anti EXOC6B pAb (ATL-HPA063991) Datasheet (External Link) |
| Vendor Page | Anti EXOC6B pAb (ATL-HPA063991) at Atlas |
| Documents & Links for Anti EXOC6B pAb (ATL-HPA063991) | |
| Datasheet | Anti EXOC6B pAb (ATL-HPA063991) Datasheet (External Link) |
| Vendor Page | Anti EXOC6B pAb (ATL-HPA063991) |