Anti EXOC5 pAb (ATL-HPA060837)

Atlas Antibodies

Catalog No: ATL-HPA060837-25

• 

Product Description

Protein Description: exocyst complex component 5
Gene Name: EXOC5
Alternative Gene Name: SEC10, SEC10L1, SEC10P
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061244: 92%, ENSRNOG00000013804: 92%
Entrez Gene ID: 10640
Uniprot ID: O00471
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TVLAKLIQNVFEIKLQSFVKEQLEECRKSDAEQYLKNLYDLYTRTTNLSSKLMEFNLGTDKQTF
• Gene Sequence: TVLAKLIQNVFEIKLQSFVKEQLEECRKSDAEQYLKNLYDLYTRTTNLSSKLMEFNLGTDKQTF
• Gene ID - Mouse: ENSMUSG00000061244
• Gene ID - Rat: ENSRNOG00000013804
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.