Description
Product Description
Protein Description: EWS RNA-binding protein 1
Gene Name: EWSR1
Alternative Gene Name: EWS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009079: 98%, ENSRNOG00000046950: 97%
Entrez Gene ID: 2130
Uniprot ID: Q01844
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: EWSR1
Alternative Gene Name: EWS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009079: 98%, ENSRNOG00000046950: 97%
Entrez Gene ID: 2130
Uniprot ID: Q01844
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GDATVSYEDPPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPG |
Gene Sequence | GDATVSYEDPPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPG |
Gene ID - Mouse | ENSMUSG00000009079 |
Gene ID - Rat | ENSRNOG00000046950 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti EWSR1 pAb (ATL-HPA062953 w/enhanced validation) | |
Datasheet | Anti EWSR1 pAb (ATL-HPA062953 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti EWSR1 pAb (ATL-HPA062953 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti EWSR1 pAb (ATL-HPA062953 w/enhanced validation) | |
Datasheet | Anti EWSR1 pAb (ATL-HPA062953 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti EWSR1 pAb (ATL-HPA062953 w/enhanced validation) |