Immunohistochemical staining of human gastrointestinal, kidney, squamous epithelia and testis using Anti-EWSR1 antibody HPA062953 (A) shows similar protein distribution across tissues to independent antibody HPA051771 (B).

Anti EWSR1 pAb (ATL-HPA062953 w/enhanced validation)

Catalog No:
ATL-HPA062953-25
$360.00
Protein Description: EWS RNA-binding protein 1
Gene Name: EWSR1
Alternative Gene Name: EWS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009079: 98%, ENSRNOG00000046950: 97%
Entrez Gene ID: 2130
Uniprot ID: Q01844
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence GDATVSYEDPPTAKAAVEWFDGKDFQGSKLKVSLARKKPPMNSMRGGLPPREGRGMPPPLRGGPG

Documents & Links for Anti EWSR1 pAb (ATL-HPA062953 w/enhanced validation)
Datasheet Anti EWSR1 pAb (ATL-HPA062953 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti EWSR1 pAb (ATL-HPA062953 w/enhanced validation) at Atlas

Documents & Links for Anti EWSR1 pAb (ATL-HPA062953 w/enhanced validation)
Datasheet Anti EWSR1 pAb (ATL-HPA062953 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti EWSR1 pAb (ATL-HPA062953 w/enhanced validation)