Anti ETV5 pAb (ATL-HPA073889)

Atlas Antibodies

Catalog No: ATL-HPA073889-25

• 

Product Description

Protein Description: ETS variant 5
Gene Name: ETV5
Alternative Gene Name: ERM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013089: 93%, ENSRNOG00000001785: 93%
Entrez Gene ID: 2119
Uniprot ID: P41161
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AAGPVQGVGPAPAPHSLPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQRQ
• Gene Sequence: AAGPVQGVGPAPAPHSLPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQRQ
• Gene ID - Mouse: ENSMUSG00000013089
• Gene ID - Rat: ENSRNOG00000001785
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.