Protein Description: ETS variant 3
Gene Name: ETV3
Alternative Gene Name: PE-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003382: 76%, ENSRNOG00000043095: 75%
Entrez Gene ID: 2117
Uniprot ID: P41162
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ETV3
Alternative Gene Name: PE-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003382: 76%, ENSRNOG00000043095: 75%
Entrez Gene ID: 2117
Uniprot ID: P41162
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SSRFHFPPLDTHSPTNDVQPGRFSASSLTASGQESSNGTDRKTELSELEDGSAADWRRGVDPVSSRNAIGGGGIGHQKR |
| Documents & Links for Anti ETV3 pAb (ATL-HPA073211) | |
| Datasheet | Anti ETV3 pAb (ATL-HPA073211) Datasheet (External Link) |
| Vendor Page | Anti ETV3 pAb (ATL-HPA073211) at Atlas |
| Documents & Links for Anti ETV3 pAb (ATL-HPA073211) | |
| Datasheet | Anti ETV3 pAb (ATL-HPA073211) Datasheet (External Link) |
| Vendor Page | Anti ETV3 pAb (ATL-HPA073211) |