![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/1280x1280/products/100211/180024/atl-hpa068389_anti-etv1-pab-atl-hpa068389_61687__51278.1681135908.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
![Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/100211/180024/atl-hpa068389_anti-etv1-pab-atl-hpa068389_61687__51278.1681135908.jpg?c=2 "Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 | Lane 2: RT4 | Lane 3: U-251 MG | Lane 4: Human Plasma | Lane 5: Liver | Lane 6: Tonsil")
Protein Description: ETS variant 1
Gene Name: ETV1
Alternative Gene Name: ER81
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004151: 94%, ENSRNOG00000006867: 94%
Entrez Gene ID: 2115
Uniprot ID: P50549
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ETV1
Alternative Gene Name: ER81
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004151: 94%, ENSRNOG00000006867: 94%
Entrez Gene ID: 2115
Uniprot ID: P50549
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | TPSSTPVSPLHHASPNSTHTPKPDRAFPAHLPPSQSIPDSSYPMDHRFRRQ |
| Documents & Links for Anti ETV1 pAb (ATL-HPA068389) | |
| Datasheet | Anti ETV1 pAb (ATL-HPA068389) Datasheet (External Link) |
| Vendor Page | Anti ETV1 pAb (ATL-HPA068389) at Atlas |
| Documents & Links for Anti ETV1 pAb (ATL-HPA068389) | |
| Datasheet | Anti ETV1 pAb (ATL-HPA068389) Datasheet (External Link) |
| Vendor Page | Anti ETV1 pAb (ATL-HPA068389) |