Protein Description: ETS variant 1
Gene Name: ETV1
Alternative Gene Name: ER81
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004151: 94%, ENSRNOG00000006867: 94%
Entrez Gene ID: 2115
Uniprot ID: P50549
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ETV1
Alternative Gene Name: ER81
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004151: 94%, ENSRNOG00000006867: 94%
Entrez Gene ID: 2115
Uniprot ID: P50549
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TPSSTPVSPLHHASPNSTHTPKPDRAFPAHLPPSQSIPDSSYPMDHRFRRQ |
Gene Sequence | TPSSTPVSPLHHASPNSTHTPKPDRAFPAHLPPSQSIPDSSYPMDHRFRRQ |
Gene ID - Mouse | ENSMUSG00000004151 |
Gene ID - Rat | ENSRNOG00000006867 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ETV1 pAb (ATL-HPA068389) | |
Datasheet | Anti ETV1 pAb (ATL-HPA068389) Datasheet (External Link) |
Vendor Page | Anti ETV1 pAb (ATL-HPA068389) at Atlas Antibodies |
Documents & Links for Anti ETV1 pAb (ATL-HPA068389) | |
Datasheet | Anti ETV1 pAb (ATL-HPA068389) Datasheet (External Link) |
Vendor Page | Anti ETV1 pAb (ATL-HPA068389) |