Protein Description: v-ets avian erythroblastosis virus E26 oncogene homolog 1
Gene Name: ETS1
Alternative Gene Name: ETS-1, EWSR2, FLJ10768
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032035: 92%, ENSRNOG00000008941: 96%
Entrez Gene ID: 2113
Uniprot ID: P14921
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ETS1
Alternative Gene Name: ETS-1, EWSR2, FLJ10768
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032035: 92%, ENSRNOG00000008941: 96%
Entrez Gene ID: 2113
Uniprot ID: P14921
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTS |
| Documents & Links for Anti ETS1 pAb (ATL-HPA063230) | |
| Datasheet | Anti ETS1 pAb (ATL-HPA063230) Datasheet (External Link) |
| Vendor Page | Anti ETS1 pAb (ATL-HPA063230) at Atlas |
| Documents & Links for Anti ETS1 pAb (ATL-HPA063230) | |
| Datasheet | Anti ETS1 pAb (ATL-HPA063230) Datasheet (External Link) |
| Vendor Page | Anti ETS1 pAb (ATL-HPA063230) |